PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000298182
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 316aa    MW: 35850.6 Da    PI: 8.338
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000298182genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.44.1e-51111351129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrFhP+deelv++yL kkv++++      + evd++k+ePwd+p+++  + kewyf+s+rd+kyatg r+nrat++gyWkatgkd+++ + k
  MDP0000298182  11 LPPGFRFHPRDEELVCDYLMKKVTQSDS---ILMIEVDLNKSEPWDIPESACVGGKEWYFYSQRDRKYATGLRTNRATATGYWKATGKDRSIRR-K 102
                    79**********************9993...3588*************7777799**************************************9.9 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                    g+lvg++ktLvfy+grapkg+k+dWvmhe+rle
  MDP0000298182 103 GSLVGMRKTLVFYQGRAPKGRKSDWVMHEFRLE 135
                    99****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.54E-592156IPR003441NAC domain
PROSITE profilePS5100556.34411155IPR003441NAC domain
PfamPF023656.1E-2712134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MSNISVVEAK LPPGFRFHPR DEELVCDYLM KKVTQSDSIL MIEVDLNKSE PWDIPESACV  60
GGKEWYFYSQ RDRKYATGLR TNRATATGYW KATGKDRSIR RKGSLVGMRK TLVFYQGRAP  120
KGRKSDWVMH EFRLEGPPKI SPLKEDWVLC RVFYKNREIA AKPSMGVSCY DDTSTLTLPA  180
LMDSYISFDG QTQIQTHTET QPQDYEQVPC FSMFSQNQTN PIFTHVDITS SQPSIPTKHN  240
NNTNTTTFGG LPNVTNFLDP FSCDKKVLKA VLSHLTKMEK SIYPTLDGSS PSFGEGSSSE  300
NYLSDVGMPK NIWSHY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-50615612166NO APICAL MERISTEM PROTEIN
1ut4_B7e-50615612166NO APICAL MERISTEM PROTEIN
1ut7_A7e-50615612166NO APICAL MERISTEM PROTEIN
1ut7_B7e-50615612166NO APICAL MERISTEM PROTEIN
3swm_A8e-50615615169NAC domain-containing protein 19
3swm_B8e-50615615169NAC domain-containing protein 19
3swm_C8e-50615615169NAC domain-containing protein 19
3swm_D8e-50615615169NAC domain-containing protein 19
3swp_A8e-50615615169NAC domain-containing protein 19
3swp_B8e-50615615169NAC domain-containing protein 19
3swp_C8e-50615615169NAC domain-containing protein 19
3swp_D8e-50615615169NAC domain-containing protein 19
4dul_A7e-50615612166NAC domain-containing protein 19
4dul_B7e-50615612166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.1550.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981230.0KF198123.1 Malus hupehensis NAC domain protein (NAC88) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383028.10.0PREDICTED: NAC domain-containing protein 21/22
SwissprotQ84TE61e-121NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLS5RUW80.0S5RUW8_9R
STRINGGLYMA15G40510.11e-161(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100103241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-115NAC domain containing protein 1